Protein Info for BACOVA_03554 in Bacteroides ovatus ATCC 8483

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 162 to 182 (21 residues), see Phobius details TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 11 to 173 (163 residues), 147.5 bits, see alignment E=4e-47 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 12 to 172 (161 residues), 74.2 bits, see alignment E=9.7e-25 PF04542: Sigma70_r2" amino acids 19 to 81 (63 residues), 34.2 bits, see alignment E=3.5e-12 PF08281: Sigma70_r4_2" amino acids 117 to 167 (51 residues), 51.1 bits, see alignment E=1.7e-17 PF04545: Sigma70_r4" amino acids 123 to 158 (36 residues), 27.9 bits, see alignment 2.6e-10 PF07638: Sigma70_ECF" amino acids 123 to 165 (43 residues), 25.1 bits, see alignment 3e-09

Best Hits

KEGG orthology group: None (inferred from 96% identity to bhl:Bache_1722)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>BACOVA_03554 RNA polymerase sigma-70 factor (Bacteroides ovatus ATCC 8483)
MENNDKQIELKFQRFFTVNFPKVKNFAQMLLKSESDAEDVAQDVFCKLWMQPELWLDNDK
ELDNYIFIMTRNIVLNIFKHQQVEQEYQTEVIEKTFLYELTEKEEILNSVYYKEMLLIIQ
LTLEKMPKRRRLIFELSRFRGLSHKEIADKLDVSIRTIEHQVYLALIELKKVLLFFIFFS
DIFK