Protein Info for BACOVA_03487 in Bacteroides ovatus ATCC 8483

Annotation: glycosyl hydrolase, family 31

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 826 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13802: Gal_mutarotas_2" amino acids 45 to 204 (160 residues), 64.1 bits, see alignment E=4.5e-21 PF01055: Glyco_hydro_31_2nd" amino acids 246 to 601 (356 residues), 298 bits, see alignment E=2.1e-92 PF21365: Glyco_hydro_31_3rd" amino acids 612 to 714 (103 residues), 84.1 bits, see alignment E=1.6e-27 PF17137: DUF5110" amino acids 730 to 798 (69 residues), 86.8 bits, see alignment E=1.7e-28

Best Hits

KEGG orthology group: K01811, putative family 31 glucosidase (inferred from 89% identity to bth:BT_3659)

Predicted SEED Role

"Alpha-xylosidase (EC 3.2.1.-)" in subsystem Xylose utilization (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (826 amino acids)

>BACOVA_03487 glycosyl hydrolase, family 31 (Bacteroides ovatus ATCC 8483)
MKMNLIRKAGFLLVCATMVAAGNGTAQNVQRTSQGIKCATQGMDVNVEFYSPSIVRVYKT
PSQKSCNKESLVIVKMPESTPVSFGEKGKNVTLSSRLIQVEVNPETGGIHFFDSSGQRLL
TDKDYGTQFTPFNDAGVPSFNVRQAFLLDKDEVIYGLGQQQTGKVNQRNQKLFLRNQNMS
ICIPFIHSVKGYALYWDNYSPTTFLDNPQEMSFDSEVGDCADYYFIYGGNADGVIAGVRE
LTGQAPLYPLWTLGFWQCRERYKSPDELCEVVDKYRELKVPLDGIIQDWQYWGCNENWNS
MKFQNPRYINKMGDPEYMKFLPNGEDRNANYGTPRIKSPKEMIDYVHKQNAHIMISVWAS
FGPWTEMYQKMDSLKALLHFETWPPKAGVKPYDPFNPTARDMYWAEMKKNIFDLGMDGWW
LDSTEPDHLEIKDKDFDTPTYLGSFRRVHNAFPLMSNKGVYEHQRATTSDKRVFLLTRSS
FLGQQRYASHSWSGDVVSTWEVMKKQLAAGLNYSLCGIPYWNTDLGGFFAWKYNNNVHNI
AYHELHVRWYQWGAFQPIMRSHNSSPVAVEIYQFGKKGDWAYDALEKYTHLRYRLLPYLY
STSWEVTNKAGSIIRPLMMDFPKDKKVLEMDTEYMFGRNFLVRPVTDSLYTWQDDKQNGY
QKNMNKIGKTDVYLPAGAQWVDFWTGKSLKGGQTIQREVPIDIMPVYVRAGSILPWGPAV
QYSTEKKWDNLTLRIYPGADAEFTLYEDEFDNYNYEKGAYTTIAMKWNDKDRTLTINDRQ
GNYKGMLKNRKFNIIIVEPGKGCGDGDATTFDQSVSYRGKRVDLKL