Protein Info for BACOVA_03345 in Bacteroides ovatus ATCC 8483

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF16334: DUF4964" amino acids 16 to 95 (80 residues), 126.5 bits, see alignment E=5.6e-41 PF17168: DUF5127" amino acids 258 to 474 (217 residues), 211.2 bits, see alignment E=3.8e-66 PF16335: DUF4965" amino acids 479 to 648 (170 residues), 235.9 bits, see alignment E=4.5e-74 PF08760: DUF1793" amino acids 654 to 818 (165 residues), 205.4 bits, see alignment E=1.7e-64

Best Hits

KEGG orthology group: None (inferred from 90% identity to bth:BT_3526)

Predicted SEED Role

"Glutaminase A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (825 amino acids)

>BACOVA_03345 hypothetical protein (Bacteroides ovatus ATCC 8483)
MKQQLMMLLLGTASVFCSCETQVEQHEKNELRAPAYPLVTIDPYTSAWSTTDNLYDSPVK
HWTGKDFSLLGVAKVDGQTYRFMGTEELELRPLVKTSEQGSWTGKYTTQQPADGWQNAGF
NDKAWKEGEAAFGTMENEHTAKTQWGEEFIWVRRVADIQEDLTGKNVYLEFSHDDDAIIY
INGIKVVDTGNACKKNERVKLSEEVVASLKPGENLIAGYCHNRVGNGLLDFGLLVELDGY
RSFHQTAQQTSVDVQPMQTYYTFTCGPVDLKLTFTAPMFMDNLDLLSRPVNYISYEVASN
DGQKHQVELYFEASPQWAIDQPHQESVADSFTDGDLLFLRTGSRNQDILKKKGDDVRIDW
GHFYLAAEKENSTYAIGDGRELRKNFVANKLEAPTTNGYDKLALVRSLGETQKADGHLLI
GYDDIYSIQYFGDNLRPYWNREGNETIVSQFQKAEKEYKTQMKNSAAFDKKLMEEATAAG
GRKYAELCALAYRQALAAHKLVQAPNGDLVFLSKENFSNGSIGTVDLTYPGAPLLLYYNP
ELVKATMNHIFYYSESGKWAKPFAAHDVGTYPLANGQTYGGDMPVEESGNMVVLAAAIAK
VEGNADYAQKHWETLTTWTDYLVENGLDPANQLCTDDFAGHFAHNANLSIKAIMGVASYG
YLADMLGKKDVAEKYTQKAKEMAAEWVKMADDGDHYRLTFDKPGTWSQKYNLVWDKLLDL
QIFPKNVAETEIAYYLSKQNKYGLPLDNRETYTKTDWIMWTATLANDKATFEKFIEPVYL
FMNVTPNRVPMSDWVFTDEPNQRGFQARSVVGGYYIKMLEGKLIK