Protein Info for BACOVA_03269 in Bacteroides ovatus ATCC 8483

Annotation: iron chelate uptake ABC transporter, FeCT family, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 122 to 146 (25 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 198 to 225 (28 residues), see Phobius details amino acids 246 to 272 (27 residues), see Phobius details amino acids 287 to 304 (18 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details PF01032: FecCD" amino acids 19 to 332 (314 residues), 254.2 bits, see alignment E=7.8e-80

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 92% identity to bth:BT_2099)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>BACOVA_03269 iron chelate uptake ABC transporter, FeCT family, permease protein (Bacteroides ovatus ATCC 8483)
MKQPDKRTPFLFITLGIVTILLLLIDMATGDTYIPITKVWAVLTGGECDEMTRNILLSIR
FIRVVVAALIGIALSVSGLQMQTVFQNPLADPYLLGVSSGAGLGVALFILGAPLLGWAEF
PILQSLGIVGSGWIGTAIILLGVAIISRKVKNILGVLIMGVMIGYVAGAIIQILQYLSSA
EQLKMFTLWSMGSLSHITVTQLGIMIPMLCIGLLISVACIKSLNLLLLGENYARTMGMNI
KRSRMFIFVSTALLTGTVTAFCGPVGFIGLAVPHVTRLLFNNADHRILVPGTMLTGLISM
LLCDIIAKKFLLPVNCITALLGVPVILWVIAKNLRRFK