Protein Info for BACOVA_03093 in Bacteroides ovatus ATCC 8483

Annotation: ribosome small subunit-dependent GTPase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF16745: RsgA_N" amino acids 2 to 60 (59 residues), 62.2 bits, see alignment E=4.8e-21 TIGR00157: ribosome small subunit-dependent GTPase A" amino acids 43 to 299 (257 residues), 226.6 bits, see alignment E=1.7e-71 PF03193: RsgA_GTPase" amino acids 63 to 239 (177 residues), 190.5 bits, see alignment E=3.4e-60 PF01926: MMR_HSR1" amino acids 178 to 241 (64 residues), 27.3 bits, see alignment E=5.1e-10

Best Hits

Swiss-Prot: 94% identical to RSGA2_BACTN: Small ribosomal subunit biogenesis GTPase RsgA 2 (rsgA2) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06949, ribosome biogenesis GTPase [EC: 3.6.1.-] (inferred from 94% identity to bth:BT_2250)

Predicted SEED Role

"Ribosome small subunit-stimulated GTPase EngC" in subsystem Universal GTPases

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>BACOVA_03093 ribosome small subunit-dependent GTPase A (Bacteroides ovatus ATCC 8483)
MKGLVIKNTGSWYQVKTDDGQSIECKIKGNFRLKGIRSTNPVAVGDRVRIILNQEGTAFI
SEIEDRKNYIIRRSSNLSKQSHILAANLDQCMLVVTINYPETSTIFIDRFLASAEAYRVP
VKLVFNKVDAYDEDELRYLDALINLYTQIGYPCFKVSAKSGTGVAEIKKALEGKITLFSG
HSGVGKSTLINSILPGIAAKTGEISSYHNKGMHTTTFSEMFPVEGDGYIIDTPGIKGFGT
FDMEEEEIGHYFPEIFKTSADCKYGNCTHRHEPGCAVRKAVEEHLISESRYTSYLNMLED
KEEGKYRAAY