Protein Info for BACOVA_02944 in Bacteroides ovatus ATCC 8483

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 178 to 194 (17 residues), see Phobius details PF07638: Sigma70_ECF" amino acids 17 to 171 (155 residues), 29.3 bits, see alignment E=1.5e-10 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 24 to 180 (157 residues), 169.4 bits, see alignment E=7.6e-54 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 25 to 180 (156 residues), 100 bits, see alignment E=1.1e-32 PF04542: Sigma70_r2" amino acids 30 to 95 (66 residues), 34.9 bits, see alignment E=2.1e-12 PF08281: Sigma70_r4_2" amino acids 126 to 178 (53 residues), 68 bits, see alignment E=8.9e-23 PF04545: Sigma70_r4" amino acids 131 to 179 (49 residues), 47.9 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: None (inferred from 39% identity to dfe:Dfer_2829)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>BACOVA_02944 RNA polymerase sigma-70 factor (Bacteroides ovatus ATCC 8483)
MPNIQQQTSDDRFLVIALKQDDKQAFTRLFHIYYKDLVLFGGTYIPEKSTCEDIVQNIFL
KLWNDRKSLVIENSLKSYLLKAVRNYCLDELRHRRIIDEHIAYELKSDSIDIDTTENYIL
YSDLCRQLKNALEQLPPQEREVFEMSRLENIKYQEIANRLNISVRTVEVRISKALKQLRI
LLKDFYLLLFLFLFH