Protein Info for BACOVA_02119 in Bacteroides ovatus ATCC 8483

Annotation: ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR00082: ribosome-binding factor A" amino acids 1 to 109 (109 residues), 66.6 bits, see alignment E=1.3e-22 PF02033: RBFA" amino acids 5 to 109 (105 residues), 99.5 bits, see alignment E=6.6e-33

Best Hits

Swiss-Prot: 50% identical to RBFA_GRAFK: Ribosome-binding factor A (rbfA) from Gramella forsetii (strain KT0803)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 96% identity to bth:BT_2839)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (110 amino acids)

>BACOVA_02119 ribosome-binding factor A (Bacteroides ovatus ATCC 8483)
METTRQNKISRLLQKELSEIFLLQTKSMPGTLVSVSAVRISPDMSIARVYLSVFPSEKAE
EMVKNINNNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK