Protein Info for BACOVA_02117 in Bacteroides ovatus ATCC 8483

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF07638: Sigma70_ECF" amino acids 8 to 174 (167 residues), 24.8 bits, see alignment E=4.6e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 18 to 176 (159 residues), 87.6 bits, see alignment E=7.1e-29 TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 18 to 176 (159 residues), 133.7 bits, see alignment E=7.2e-43 PF04542: Sigma70_r2" amino acids 23 to 87 (65 residues), 42.9 bits, see alignment E=8.5e-15 PF08281: Sigma70_r4_2" amino acids 121 to 169 (49 residues), 53.3 bits, see alignment E=4.5e-18 PF04545: Sigma70_r4" amino acids 125 to 172 (48 residues), 29.1 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 54% identity to bfs:BF0232)

Predicted SEED Role

"putative ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>BACOVA_02117 RNA polymerase sigma-70 factor (Bacteroides ovatus ATCC 8483)
MKLENNEICRIVDGDEIAFNRFMEHYSSRLYHYTFALLGQKESAEEIVSDVFFEVWKNRK
SLAEIGNMNAWIQTITYRKAISFLRKETGKYELSFDDIEDFIFEPVQSPAEEMISKEEMA
KINDAIQQLPPKCKHVFFLAKIDGLPYKDIADMLNISVKTINNHIAFALDEIAKRLNLKS
RKS