Protein Info for BACOVA_01913 in Bacteroides ovatus ATCC 8483

Annotation: ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 PF13589: HATPase_c_3" amino acids 28 to 126 (99 residues), 35.9 bits, see alignment E=7.1e-13 PF00183: HSP90" amino acids 236 to 372 (137 residues), 32.5 bits, see alignment E=5.1e-12

Best Hits

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 88% identity to bfs:BF0194)

Predicted SEED Role

"Heat shock protein htpG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>BACOVA_01913 ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein (Bacteroides ovatus ATCC 8483)
MEKEGNNLFQVNLKGMIALLSEHIYSNPNTFVRELLQNCVDAITALRNIDENYKGRIDVF
LNEDKTVVFRDNGIGLKEEEVYRFLTVIGESSKRDTPDADDFIGRFGIGLLSCFVVTNEI
TVESRSAMGGQPVCWCGKVDGTYQLTLSDEERPIGSQVVLHPKGDWMHLFEYETFKKILV
GYGEVLPYPIYLHYQGEEELVNTPSPVWLDPKATRKELLDYGAKVFQSSALDAFRIYTES
GKVEGVLYVLPFRTQFSVRNSHKVYLKRMLLSEDDCNLLPSWAFFIRCLVNADGLLSTAS
RESLVSNDQLKDARKEIGVAIKDYLRGLVQNDRAMFNRILDVHHFHIKAIASEDNELLRL
FMDYLPFETNKGLRSFGSIRSASNVICYTKNLEDFRQVRRIAGAQGWLVVNAAYTFDETL
LKKYVRLNPELTLDEISPSRLLEQFGEVEANQEFQAFEVKANELLKRFGCICRLKHFTPV
DIPVIFVAEEKENAAKSANNPLAAVLGAVNTTKQIPPTLTFNADNEMVQTLLQIQGDNKL
FQHVVHILYVQSLLQGKYPVNSEEMELFNHSLSELMTSKMNDFINFLN