Protein Info for BACOVA_01584 in Bacteroides ovatus ATCC 8483

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 PF00005: ABC_tran" amino acids 20 to 168 (149 residues), 106.6 bits, see alignment E=1.7e-34

Best Hits

Swiss-Prot: 52% identical to Y796_METJA: Uncharacterized ABC transporter ATP-binding protein MJ0796 (MJ0796) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K02003, (no description) (inferred from 94% identity to bth:BT_2494)

MetaCyc: 42% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein YvcR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (238 amino acids)

>BACOVA_01584 ABC transporter, ATP-binding protein (Bacteroides ovatus ATCC 8483)
MIQLTNINKTYNNGAPLHVLKGINLNIEQGEFVSIMGASGSGKSTLLNILGILDNYDTGD
YYLNNVLIKNLSETKAAEYRNRMIGFIFQSFNLISFKDAVENVALPLFYQGISRKKRNAL
ALEYLDRLGLKDWAHHMPNEMSGGQKQRVAIARALITQPQIILADEPTGALDSKTSVEVM
QILKDLHKLGMTIVVVTHESGVANQTDKIIHIKDGIIERIEDNIDHDASPFGKDGIMK