Protein Info for BACOVA_01163 in Bacteroides ovatus ATCC 8483

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF13181: TPR_8" amino acids 199 to 229 (31 residues), 12.5 bits, see alignment (E = 0.0001) amino acids 232 to 263 (32 residues), 20.3 bits, see alignment 3.3e-07 amino acids 265 to 297 (33 residues), 13.2 bits, see alignment 6e-05 PF13432: TPR_16" amino acids 214 to 262 (49 residues), 26.1 bits, see alignment 6.9e-09 amino acids 237 to 297 (61 residues), 26.2 bits, see alignment E=6.7e-09 PF13428: TPR_14" amino acids 232 to 273 (42 residues), 24.2 bits, see alignment 2.8e-08 PF00515: TPR_1" amino acids 232 to 264 (33 residues), 30.9 bits, see alignment 1.2e-10 PF13174: TPR_6" amino acids 232 to 263 (32 residues), 19.4 bits, see alignment 8.9e-07 PF07719: TPR_2" amino acids 233 to 263 (31 residues), 29.6 bits, see alignment (E = 3.2e-10) PF13374: TPR_10" amino acids 233 to 260 (28 residues), 15 bits, see alignment (E = 1.4e-05) PF13431: TPR_17" amino acids 253 to 283 (31 residues), 22.1 bits, see alignment (E = 9e-08)

Best Hits

KEGG orthology group: None (inferred from 91% identity to bth:BT_3937)

Predicted SEED Role

"TPR domain protein, putative component of TonB system" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>BACOVA_01163 tetratricopeptide repeat protein (Bacteroides ovatus ATCC 8483)
MPNFFKSFFSGKSETPESEKQKNDQKNFEIFKYDGLRAQRMGRPDYAVKCFIEALAIKEE
FETMGYLSQLYIQMGETAKARELLEKMAAMEPDVTSTFLTLANVCFIQEDYQAMEEAANK
AIAIEEGNAVAHYLLGKARKGQDDDLMTIAHLTKAITLKDDFIEARLLRAEALMNLKQYK
DMMEDIDAVLAQNPEEETAMLLRGKVKEADGKDEEAEEDYKLVTEINPFNEQAYLYLGQL
YINQKKLTEAIGLFDEAIELNPNFAEAYKERGRAKLLNGDKDGSVEDMKKSLELNPKEEA
GLNGEFKNLGPKPEALPGIF