Protein Info for BACOVA_01104 in Bacteroides ovatus ATCC 8483

Annotation: CoA binding domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06971: Put_DNA-bind_N
  • amino acids 11 to 59 (49 residues), 67.9 bits, E=6.5e-23
• PF02629: CoA_binding
  • amino acids 88 to 184 (97 residues), 78.9 bits, E=4.1e-26

Best Hits

Swiss-Prot: 88% identical to REX_BACFN: Redox-sensing transcriptional repressor Rex (rex) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K01926, AT-rich DNA-binding protein (inferred from 87% identity to bvu:BVU_1637)

Predicted SEED Role

"Redox-sensitive transcriptional regulator (AT-rich DNA-binding protein)" in subsystem Oxidative stress

Protein Sequence (216 amino acids)

>BACOVA_01104 CoA binding domain protein (Bacteroides ovatus ATCC 8483)
MSTSIRKEADKVPEPTLRRLPWYLSNIKLMKEKGEQYVSSTQISKEINIDASQIAKDLSY
VNISGRTRVGYNIDALIEVLESFLGFTNMHKAFLFGVGSLGAALLRDSGLHHFGLEIVAA
FDVNPELVGKDLNGIPIFHSDDFEAKMKEYDVNIGVLTVPINIAQEITDKMVDGGIKAVW
NFTPFRIRVPENIVVQNTSLYAHLAVMFNRLNFNEK