Protein Info for BACOVA_01101 in Bacteroides ovatus ATCC 8483

Annotation: translation elongation factor Ts

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00116: translation elongation factor Ts" amino acids 1 to 327 (327 residues), 217.8 bits, see alignment E=9.1e-69 PF00889: EF_TS" amino acids 70 to 218 (149 residues), 127.6 bits, see alignment E=2.5e-41 amino acids 248 to 327 (80 residues), 55.8 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 94% identical to EFTS_BACTN: Elongation factor Ts (tsf) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02357, elongation factor Ts (inferred from 94% identity to bth:BT_3878)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>BACOVA_01101 translation elongation factor Ts (Bacteroides ovatus ATCC 8483)
MAVSMADITKLRKMTGAGMMDCKNALTEAEGDFDKAMEIIRKKGQAVAAKRSEREASEGC
VLAKTTGDRAVIVALKCETDFVAQNADFVKLTQDILDLAVANKCATLDEVKALPMGNGTV
QDAVTDRSGITGEKMELDGYMTVEGVCTAVYNHMNRNGLCTIVAFNKEVNEQLAKQIAMQ
IAAMNPIAIDEDGVSEEVKQKEIEVAIEKTKAEQVQKAVEAALKKANINPAHVDSEEHMD
SNMAKGWITAEDVAKAKEIIATVSAEKAAHLPEQMIQNIAKGRLGKFLKEVCLLNQEDIM
DGKKTVREVLAAADPELKIVDFKRFTLKAE