Protein Info for BACOVA_01040 in Bacteroides ovatus ATCC 8483

Annotation: 50S ribosomal protein L11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01632: ribosomal protein uL11
  • amino acids 3 to 140 (138 residues), 210.1 bits, E=5.9e-67
• PF03946: Ribosomal_L11_N
  • amino acids 9 to 66 (58 residues), 95.9 bits, E=9.5e-32
• PF00298: Ribosomal_L11
  • amino acids 71 to 139 (69 residues), 91.7 bits, E=3.1e-30

Best Hits

Swiss-Prot: 99% identical to RL11_BACFN: 50S ribosomal protein L11 (rplK) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K02867, large subunit ribosomal protein L11 (inferred from 99% identity to bth:BT_2738)

MetaCyc: 54% identical to 50S ribosomal subunit protein L11 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L11p (L12e)" in subsystem Ribosome LSU bacterial

Protein Sequence (147 amino acids)

>BACOVA_01040 50S ribosomal protein L11 (Bacteroides ovatus ATCC 8483)
MAKEVAGLIKLQIKGGAANPSPPVGPALGSKGINIMEFCKQFNARTQDKAGKILPVIITY
YADKSFDFVIKTPPVAIQLLEVAKVKSGSAEPNRKKVAELTWEQVRTIAQDKMVDLNCFT
VEAAMRMVAGTARSMGIAVKGEFPVNN