Protein Info for BACOVA_00877 in Bacteroides ovatus ATCC 8483

Annotation: biotin carboxylase domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 PF02786: CPSase_L_D2" amino acids 1 to 114 (114 residues), 145.2 bits, see alignment E=2e-46 PF02785: Biotin_carb_C" amino acids 128 to 234 (107 residues), 139.5 bits, see alignment E=4.3e-45

Best Hits

Predicted SEED Role

"Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14)" in subsystem Fatty Acid Biosynthesis FASII (EC 6.3.4.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.14

Use Curated BLAST to search for 6.3.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>BACOVA_00877 biotin carboxylase domain protein (Bacteroides ovatus ATCC 8483)
IEVQIMGDKYGNVVHLYERECSIQRRNQKVIEESPSPFVKEETRKKMLKVAVEACKKIGY
YSAGTLEFMMDKDQNFYFLEMNTRLQVEHPVTEECTGVDLVRDMITVAAGNPLPYKQDDI
EFSGAAIECRIYAEDPENNFMPSPGVITVREAPEGRNLRLDSAAYAGFEVSLHYDPMIAK
LCCWGRTRASAISNMARALREYKILGIKTTIPFHQRVLKNAAFLKGEYDTTFIDTRFDKE
DLKRRQNTDPTVAVIAAAVRHYEREKEAASRATTLPVVGESLWKYYGKLQMTANNY