Protein Info for BACOVA_00551 in Bacteroides ovatus ATCC 8483

Annotation: ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 PF00005: ABC_tran" amino acids 18 to 184 (167 residues), 80.6 bits, see alignment E=1.8e-26 amino acids 337 to 466 (130 residues), 31.9 bits, see alignment E=2e-11 PF12848: ABC_tran_Xtn" amino acids 223 to 305 (83 residues), 73.7 bits, see alignment E=1.1e-24

Best Hits

Swiss-Prot: 58% identical to YKPA_BACSU: Uncharacterized ABC transporter ATP-binding protein YkpA (ykpA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 98% identity to bth:BT_1242)

Predicted SEED Role

"ABC transporter ATP-binding protein uup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>BACOVA_00551 ABC transporter, ATP-binding protein (Bacteroides ovatus ATCC 8483)
MITVSNVSVQFGKRVLFNDVNLKFTSGNCYGIIGANGAGKSTFLRTIYGDLDPTTGTIAL
GPGERLSVLSQDHFKWDSYTVMDTVMMGHTVLWDIMKQREELYAKEDFTDEDGLKVSELE
EKFAELDGWNAESDAAMLLSGLGVKEDKHYVLMGELSGKEKVRVMLAQALYGNPDNLLLD
EPTNDLDMETVTWLEEYLANFEHTVLVVSHDRHFLDSVCTHTVDIDYGKINMFAGNYSFW
YESSQLALRQQQNQKAKAEEKKKELEEFIRRFSANVAKSKQTTSRKKMLEKLNVEEIKPS
SRKYPGIIFTPEREPGNQILEVSGLSKKTEEGVVLFNDVNFNVEKGDKVVFLSRNPRAMT
AFFEIINGNMKPDAGTFNWGVTITTAYLPLDNTDFFNSDLNLVDWLSQFGEGNEVYMKGF
LGRMLFSGEEVLKKVSVLSGGEKMRCMIARMQLRNANCLILDTPTNHLDLESIQAFNNNL
KTYKGNILFSSHDHEFIQTVANRIIELTPNGIIDKMMEYDEYITSDHIKELRAKMYGDK