Protein Info for BACOVA_00388 in Bacteroides ovatus ATCC 8483

Annotation: anaerobic sulfatase maturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 TIGR03942: anaerobic sulfatase maturase" amino acids 15 to 390 (376 residues), 486.9 bits, see alignment E=3.8e-150 PF04055: Radical_SAM" amino acids 21 to 189 (169 residues), 74 bits, see alignment E=1.7e-24 TIGR04085: radical SAM additional 4Fe4S-binding SPASM domain" amino acids 283 to 371 (89 residues), 65.2 bits, see alignment E=5.7e-22 PF13186: SPASM" amino acids 289 to 343 (55 residues), 37.5 bits, see alignment 2.4e-13

Best Hits

Swiss-Prot: 91% identical to ANSME_BACTN: Anaerobic sulfatase-maturating enzyme (chuR) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06871, (no description) (inferred from 91% identity to bth:BT_0238)

Predicted SEED Role

"Putative arylsulfatase regulatory protein" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>BACOVA_00388 anaerobic sulfatase maturase (Bacteroides ovatus ATCC 8483)
MKTSTFAPFAKPLYVMVKPVGAVCNLACDYCYYLEKANLYKDNLKHVMSDELLEKFIDEY
INSQTMPQVLFTWHGGETLMRPLSFYKKAMELQKKYARGRTIDNCIQTNGTMLTDEWCEF
FRENNWLVGVSIDGPQEFHDEYRKNKMGKPSFVKVMQGINLLKKHGVEWNAMAVINDFNA
DYPLDFYRFFKEIGCQYIQFAPIVERILSHEDGRHLASLAENKAGTLADFSITPEQWGNF
LCALFDEWVKEDVGKYYVQIFDSTLANWMGEQPGICTMAKTCGHAGVMEFNGDVYSCDHF
VFPEYKLGNIYSKTLVEMMHSERQHNFGNMKYQSLPTQCKECEFLFACNGECPKNRFSQT
AEGEPGLNYLCKGYYQFFKHVAPYMDFMKNELMNQRPPANIMEALKNGDLKIEY