Protein Info for BACOVA_00381 in Bacteroides ovatus ATCC 8483

Annotation: putative thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 2 to 95 (94 residues), 91.8 bits, E=3.7e-30
• TIGR01068: thioredoxin
  • amino acids 2 to 97 (96 residues), 104.3 bits, E=1.7e-34
• PF13098: Thioredoxin_2
  • amino acids 13 to 92 (80 residues), 37 bits, E=5.7e-13

Best Hits

Swiss-Prot: 45% identical to THIO2_CORNE: Thioredoxin C-2 from Corynebacterium nephridii

KEGG orthology group: None (inferred from 90% identity to bth:BT_0219)

MetaCyc: 38% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"TRX family"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (1/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (99 amino acids)

>BACOVA_00381 putative thioredoxin (Bacteroides ovatus ATCC 8483)
MEKFEDLIQSPVPVLVDFFAGWCGPCKAMKPVLEELKLIVGDKARIAKIDVDQHEDLATK
YRIQAVPTFILFKNGEAVWRHSGIIHSSELQGVIEKHYT