Protein Info for BACOVA_00154 in Bacteroides ovatus ATCC 8483

Annotation: RNA polymerase sigma-70 factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 160 to 179 (20 residues), see Phobius details TIGR02985: RNA polymerase sigma-70 factor, Bacteroides expansion family 1" amino acids 10 to 169 (160 residues), 150.5 bits, see alignment E=4.8e-48 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 11 to 169 (159 residues), 86.6 bits, see alignment E=1.4e-28 PF04542: Sigma70_r2" amino acids 15 to 80 (66 residues), 44.7 bits, see alignment E=1.9e-15 PF07638: Sigma70_ECF" amino acids 113 to 162 (50 residues), 24.1 bits, see alignment E=6.1e-09 PF08281: Sigma70_r4_2" amino acids 115 to 165 (51 residues), 53.4 bits, see alignment E=3.3e-18 PF04545: Sigma70_r4" amino acids 122 to 160 (39 residues), 25.9 bits, see alignment 1.1e-09

Best Hits

KEGG orthology group: None (inferred from 56% identity to bth:BT_1278)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>BACOVA_00154 RNA polymerase sigma-70 factor (Bacteroides ovatus ATCC 8483)
MDKDITLEQEFDLVFKAHYSLVKNFALMLLKSGQDADDIAQDVFTRLWAKPQIWQDNPGI
DKYIYAMTKHAIFDFLKHKRIERSYQQAQMEESLFKDLSPSGDTLDAIYYKEIQLALQMA
VEQFPERRRLIFEMSRIQGMSHLEIAEKLDISVRTVERQIYLSLVELKKIVFILFFLHFI