Protein Info for BACOVA_00077 in Bacteroides ovatus ATCC 8483

Annotation: ATP synthase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 transmembrane" amino acids 6 to 32 (27 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 126 to 152 (27 residues), see Phobius details PF00137: ATP-synt_C" amino acids 10 to 68 (59 residues), 56.4 bits, see alignment E=1.4e-19 amino acids 89 to 148 (60 residues), 52.4 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: K02124, V-type H+-transporting ATPase subunit K [EC: 3.6.3.14] (inferred from 98% identity to bfs:BF2743)

Predicted SEED Role

"V-type ATP synthase subunit K (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>BACOVA_00077 ATP synthase subunit C (Bacteroides ovatus ATCC 8483)
MEMNLFIAYIGIAIMVGLSGIGSAYGVTIAGNAAIGALKKNDSAFGNFLVLTALPGTQGL
YGFAGYFMFQTIFGILTPEITPIQASAVLGAGIALGLVALFSAIRQGQVCANGIAAIGQG
HNVFSNTLILAVFPELYAIVALAATFLIGSALVA