Protein Info for B158DRAFT_2444 in Kangiella aquimarina DSM 16071

Annotation: dihydrodipicolinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00701: DHDPS" amino acids 2 to 287 (286 residues), 341.5 bits, see alignment E=1.4e-106 TIGR00674: 4-hydroxy-tetrahydrodipicolinate synthase" amino acids 4 to 287 (284 residues), 350.3 bits, see alignment E=2.9e-109

Best Hits

Swiss-Prot: 55% identical to DAPA_ACIF2: 4-hydroxy-tetrahydrodipicolinate synthase (dapA) from Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)

KEGG orthology group: K01714, dihydrodipicolinate synthase [EC: 4.2.1.52] (inferred from 92% identity to kko:Kkor_1627)

MetaCyc: 52% identical to 4-hydroxy-tetrahydrodipicolinate synthase (Escherichia coli K-12 substr. MG1655)
DIHYDRODIPICSYN-RXN [EC: 4.3.3.7]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7)" (EC 4.3.3.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.52 or 4.3.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>B158DRAFT_2444 dihydrodipicolinate synthase (Kangiella aquimarina DSM 16071)
MFSGSIVAIVSPLLSDGSIDENALRELIEWHINEGTHGIVIMGTTGESATVESKDYQAAI
ELTVKQVAGRVPVIAGTGSISTKKTIALTQQAEAMGVDAALVVTPYYCKPSQEGLFQHFK
AVAENTKLPIILYNVPGRTACDLNPNTVARLAELNNIVAIKEATGDISRVEELNRVCKTP
ITLLSGDDATALEFMKLGGHGVISVTANVAPALMSKMCELAKAEQWKQATVINEKLSALH
QDLFVEANPIPVKWALAKMGKCEETILLPLTVLAEQYHSQVLQALEQANVDIK