Protein Info for B158DRAFT_2409 in Kangiella aquimarina DSM 16071

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 73 to 92 (20 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 8 to 169 (162 residues), 144.6 bits, see alignment E=1.3e-46 PF01252: Peptidase_A8" amino acids 17 to 162 (146 residues), 145.2 bits, see alignment E=8.3e-47

Best Hits

Swiss-Prot: 50% identical to LSPA_YERE8: Lipoprotein signal peptidase (lspA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 89% identity to kko:Kkor_1663)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>B158DRAFT_2409 lipoprotein signal peptidase (Kangiella aquimarina DSM 16071)
MKKLPFRQSGLVWLWLTAVLLIIDQVTKTWANTALAPVHGGPIIEVMPHFNLNLAYNYGA
AFSFLGDAGGWQRWFFTAIAIGISLLLLFWMWRTESHKKLPNIGMALILSGAFGNLIDRM
VYGYVIDFIDWYVSIDGYHWPTFNIADSVILIGVGLLLIDSFINPEHKSKPEKTRKNNED