Protein Info for B158DRAFT_2333 in Kangiella aquimarina DSM 16071

Annotation: rhomboid family GlyGly-CTERM serine protease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 45 to 71 (27 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 134 to 151 (18 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details TIGR03902: rhombosortase" amino acids 31 to 181 (151 residues), 137.1 bits, see alignment E=2.4e-44 PF01694: Rhomboid" amino acids 40 to 185 (146 residues), 52.7 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: None (inferred from 83% identity to kko:Kkor_0904)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>B158DRAFT_2333 rhomboid family GlyGly-CTERM serine protease (Kangiella aquimarina DSM 16071)
MTQFLKKYVFALLLSHICIISYLLLPQSNLWMAYDRVLVDSGQWWRFITANLVHLGGWHT
VMNLASLWLISFIFQPLLRPSYWISWVLLLYCVNILAMHLWTPHITHYVGMSGALYGLIA
ACATAELRLGVKISGVLLLIVGIKIFLPQIIGVEAEYDDFLGGAVIEESHIIGFIQGIIL
GLLWPKQLLNGPALKTILKSKRSDP