Protein Info for B158DRAFT_2199 in Kangiella aquimarina DSM 16071

Annotation: multisubunit sodium/proton antiporter, MrpB subunit (TC 2.A.63.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 26 to 47 (22 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 79 to 102 (24 residues), see Phobius details amino acids 114 to 131 (18 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 278 to 298 (21 residues), see Phobius details amino acids 319 to 343 (25 residues), see Phobius details PF13244: MbhD" amino acids 38 to 99 (62 residues), 58.7 bits, see alignment E=7.7e-20 PF20501: MbhE" amino acids 135 to 196 (62 residues), 35.8 bits, see alignment E=1e-12 PF04039: MnhB" amino acids 216 to 337 (122 residues), 90.3 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K05566, multicomponent Na+:H+ antiporter subunit B (inferred from 87% identity to kko:Kkor_0767)

Predicted SEED Role

"PH adaptation potassium efflux system protein B1; sodium- potassium/hydrogen antiporter subunit B1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>B158DRAFT_2199 multisubunit sodium/proton antiporter, MrpB subunit (TC 2.A.63.1) (Kangiella aquimarina DSM 16071)
MTFLKNSVSLLLNQQTIKRELLRSTVIEITINVILLALLTLTAISLAFTKDLFASVMLMG
VYSLLSASFFVLMDAVDVAFTEAAVGAGISTILMLTVLAMAGRFENRALHHPRIALFVVI
GTGIMLVFGTFDMPAFGDINAPVQTHVAPHYIQQSGAEIDIPNIVTSVLASYRGFDTFGE
VVVVFTAVIGVLALLEMKSEEVRNSVAPAPMYQHKILRIVGKILIPPIMLFALYVQFHGE
YGPGGGFQAGVIFSAAIILHAILFGVETTAKAISLPFVKVLAALGVLIYGSVGIVAMLNG
GRFLEYNALAENAITGQHVGIIVIELGVGITVATAMMVIFLTFARRVGKSNGESA