Protein Info for B158DRAFT_2055 in Kangiella aquimarina DSM 16071

Annotation: DNA-binding winged-HTH domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 125 to 143 (19 residues), see Phobius details PF00486: Trans_reg_C" amino acids 28 to 100 (73 residues), 66.6 bits, see alignment E=6.9e-22 PF13432: TPR_16" amino acids 259 to 303 (45 residues), 26.2 bits, see alignment 3.7e-09 PF07719: TPR_2" amino acids 277 to 307 (31 residues), 27.8 bits, see alignment (E = 7e-10) PF00515: TPR_1" amino acids 278 to 307 (30 residues), 31.6 bits, see alignment (E = 4.2e-11) PF13181: TPR_8" amino acids 281 to 305 (25 residues), 17.1 bits, see alignment (E = 2e-06)

Best Hits

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>B158DRAFT_2055 DNA-binding winged-HTH domains (Kangiella aquimarina DSM 16071)
MDNQDTLQILEWRCNLSTGEISNGHETQTLEPKSIELLFFMAQNHSRVLSKDQIIEAVWN
NAIVSDDVLAKTISKLRKALNDNPKEPRFIETLPKRGYRFKVVPTTSDSAQPTPITEKKP
HRRKFFLPIWLFIMVVSLVTVFTQRRNNEQKTDQSDQELNQEEQQKLSPELQNLKEQADN
YYFQYTRTDNENAIKLYERIIAAEPEFGPAQSGLATALVQKVLRWPNELGTPDINHSSLT
QAHQEQRLASPEAQLYLSRAEALAERAVRLSPNDYMVHRSLGLVYAAQQQYAEAEKHYDK
AIELNHNAWGAMINKAEIAQLNGDDERYLQLMEQAYQAMTNVYDQQVAKVRPWYPKIGVA
IADKYVQLNEPQEAEIWYRTVLNYSPLDKDANVGLMNLMQANGQQESYQEICQRIRLSID
PESNCNQ