Protein Info for B158DRAFT_2036 in Kangiella aquimarina DSM 16071

Annotation: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02441: Flavoprotein
  • amino acids 11 to 196 (186 residues), 145 bits, E=8.1e-47
• TIGR00421: polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases
  • amino acids 13 to 206 (194 residues), 185.2 bits, E=4.7e-59

Best Hits

Swiss-Prot: 64% identical to UBIX_VIBCH: Flavin prenyltransferase UbiX (ubiX) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03186, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase UbiX [EC: 4.1.1.-] (inferred from 92% identity to kko:Kkor_0603)

MetaCyc: 57% identical to flavin prenyltransferase (Pseudomonas aeruginosa)
RXN-16937 [EC: 2.5.1.129]

Predicted SEED Role

"3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX (EC 4.1.1.-)" in subsystem Ubiquinone Biosynthesis (EC 4.1.1.-)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (10/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (6/8 steps found)
• prenylated FMNH₂ biosynthesis (2/3 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 2.5.1.129 or 4.1.1.-

Protein Sequence (211 amino acids)

>B158DRAFT_2036 polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylases (Kangiella aquimarina DSM 16071)
MSESSKQQAGKAITLAVTGASGAPYALRLLEQLTHHYDTVYLMLSSAARVVFATEVLVQV
SKAPSVIEKELTEHLGIAEGKIKAFSSDNWMSPVASGSSAPKQMIVCPCSTGTLSAIAHG
ASDNLIERAADVVLKERGQLLLVPREMPYNTIHLQNMTKLSEMGVTIMPASPGFYNEPKT
IDDLVDFVVARILDHLDIDHNLGHRWGYSKD