Protein Info for B158DRAFT_1901 in Kangiella aquimarina DSM 16071

Annotation: DNA-directed RNA polymerase subunit alpha (EC 2.7.7.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 22 to 313 (292 residues), 370.8 bits, see alignment E=2.4e-115 PF01193: RNA_pol_L" amino acids 27 to 225 (199 residues), 88.8 bits, see alignment E=2.3e-29 PF01000: RNA_pol_A_bac" amino acids 57 to 175 (119 residues), 122.4 bits, see alignment E=1.8e-39 PF03118: RNA_pol_A_CTD" amino acids 241 to 305 (65 residues), 88.5 bits, see alignment E=2.9e-29

Best Hits

Swiss-Prot: 73% identical to RPOA_PSEA7: DNA-directed RNA polymerase subunit alpha (rpoA) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 99% identity to kko:Kkor_0462)

MetaCyc: 71% identical to RNA polymerase subunit alpha (Escherichia coli K-12 substr. MG1655)
DNA-directed RNA polymerase. [EC: 2.7.7.6]

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>B158DRAFT_1901 DNA-directed RNA polymerase subunit alpha (EC 2.7.7.6) (Kangiella aquimarina DSM 16071)
MSATEFLTPRQIKVESSEGTKARVVLEPFERGFGHTLGNSLRRILLSSMPGAAVTEVEID
GVLHEYSAIEGVQEDVIDILLNLKGLAVRLEDKEVATLTLQKKGEGVVTAADIEEVSGAE
VVNKDHYIATLNKGGALNMRIKVRLGRGYEASNTRKQPEGEDKPIGVLQVDASFSPMKKV
SYTVESARVEQRTDLDKLVLDLETNGTIDPEEAIRRSATILQEQLAAFVDLKDEKQAEPE
KEEPEIDPILLRPVDDLELTVRSANCLKTENIHYIGDLVQRTEVELLKTPNLGKKSLTEI
KDVLASRGLSLGMRLENWPPSSIIGD