Protein Info for B158DRAFT_1821 in Kangiella aquimarina DSM 16071

Annotation: DNA segregation ATPase FtsK/SpoIIIE and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 116 to 141 (26 residues), see Phobius details amino acids 159 to 193 (35 residues), see Phobius details PF13491: FtsK_4TM" amino acids 26 to 200 (175 residues), 136.5 bits, see alignment E=1.5e-43 PF17854: FtsK_alpha" amino acids 284 to 384 (101 residues), 110.5 bits, see alignment E=8.5e-36 PF01580: FtsK_SpoIIIE" amino acids 391 to 605 (215 residues), 258.8 bits, see alignment E=7.7e-81 PF09397: FtsK_gamma" amino acids 713 to 773 (61 residues), 91.6 bits, see alignment 4e-30

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 91% identity to kko:Kkor_1119)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (779 amino acids)

>B158DRAFT_1821 DNA segregation ATPase FtsK/SpoIIIE and related proteins (Kangiella aquimarina DSM 16071)
MSKTKTKQSATRKSPQSLESRAILRRRLSEGGMILLVTLALFFLLALLTYNPNDPGSFTN
GSGGPIQNAAGKGGAWFADFFLHLFGYLAFLIPIIFAYSGYLLYVERNIEHEHPKAFWAV
KGLGLLMAVVGGAGLCSLHFFDPAIQPSYSSGGILGEFIISLIIDGLGLYGTTLILLALF
LSGLTLFTGISWLRTMDKVGVWVIKSWGKLLEWYENFKDRKLEQKSVKESVVKRQEALKQ
EKVKRETRSPVKIEPKVMQPSTPPKAVQKAKQKPLFDDIPTGPMPVMELLDEPEPPKNHF
SEEALEAMSRLVELKLKDFGVEAQVMEVHPGPVITRFEIELAPGVKVSKISNLAKDLARS
LSTISVRVVEVIPGKTYVGIEIPNESREVVRLREVLACDEFEKSKAPLSMALGKDIAGNP
IVVNMAKMPHLLVAGTTGSGKSVGVNAMIISMLYKATPEDLRLIMIDPKMLELSVYEGIP
HLLCEVVTDMKDAANALRWSVGEMERRYRLMSAMGVRNLAGFNKKIQDAIKAGEPIKDPL
WQPTDGLEEEPPTLEKLPSIVIVIDELADMMMIVGKKVEELIARIAQKARAAGIHLILAT
QRPSVDVITGLIKANIPSRIAFQVSSKIDSRTILDQMGAEQLLGMGDMLYLPGGSNIPTR
IHGAFVDDDEVHRVVEDWKKRGEPEYLDEVISGTSEVPVPGIPGMDGADSDSEQDELFDQ
AVAIVTETRRASISGIQRRLKIGYNRAARMVEAMEAAGIVSEMGSNGAREVLAPPPPKD