Protein Info for B158DRAFT_1819 in Kangiella aquimarina DSM 16071

Annotation: ATPase related to the helicase subunit of the Holliday junction resolvase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF05496: RuvB_N" amino acids 21 to 139 (119 residues), 51.4 bits, see alignment E=3.3e-17 PF07728: AAA_5" amino acids 54 to 160 (107 residues), 27.2 bits, see alignment E=1.1e-09 PF00004: AAA" amino acids 54 to 162 (109 residues), 69.5 bits, see alignment E=1.2e-22 PF16193: AAA_assoc_2" amino acids 188 to 268 (81 residues), 84.1 bits, see alignment E=1.9e-27 PF12002: MgsA_C" amino acids 269 to 435 (167 residues), 227 bits, see alignment E=4.1e-71

Best Hits

Swiss-Prot: 61% identical to RARA_COXBU: Replication-associated recombination protein A (rarA) from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)

KEGG orthology group: K07478, putative ATPase (inferred from 93% identity to kko:Kkor_1121)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>B158DRAFT_1819 ATPase related to the helicase subunit of the Holliday junction resolvase (Kangiella aquimarina DSM 16071)
MSGQSNLFSDSPLNAPLADRLRPTSLENYVGQEHLLAPGKPLRQAIDTKRPFSLIFWGPP
GTGKTTLARLIAQSSNAHFITISAVLAGVKDIRAAVDEARQYQAQGKPTILFVDEVHRFN
KAQQDAFLPYVEDGTLTFIGATTENPSFELNNALLSRARVFVLKDLSESALDKLISRALT
DEDLGLGKYHLYIAEESRKHLIDAADGDGRRLLNFLELASELALAKDDESPVIDDEVLEE
TLTQSLRRFDKGGEHFYDQISALHKSVRGSNPDGALYWFCRMIDGGCDPLYVARRVVRMA
SEDIGNADPRGLTLALNAWDVQERLGSPEGELAIAQAIIYLACAPKSNAVYMAYNNALRD
VKNEPTYEVPMHIRNAPTKLMKELDYGTGYRYDHDEPDAFSAGQTYFPDEKGETQYYHPV
DRGLEKKIADKLAWLKAKSEQFNKG