Protein Info for B158DRAFT_1767 in Kangiella aquimarina DSM 16071

Annotation: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 659 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03938: poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB" amino acids 40 to 648 (609 residues), 796.9 bits, see alignment E=5.4e-244 PF01522: Polysacc_deac_1" amino acids 97 to 260 (164 residues), 99 bits, see alignment E=1.9e-32 PF14883: GHL13" amino acids 307 to 628 (322 residues), 417.7 bits, see alignment E=3e-129

Best Hits

KEGG orthology group: K11931, biofilm PGA synthesis lipoprotein PgaB [EC: 3.-.-.-] (inferred from 62% identity to kko:Kkor_1173)

Predicted SEED Role

"Biofilm PGA synthesis deacetylase PgaB (EC 3.-)"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (659 amino acids)

>B158DRAFT_1767 poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB (Kangiella aquimarina DSM 16071)
MRLQTFSVYCLLIFLWLFPVQTIANNQAASSSLIRTNGDFFALCYHDVKPHGLTLQQTDE
GTVTTRHLVEHFEWLKDNGYTVVSLDEIIKAKSGQQSLPEKAVLLTFDDGYKSFYTQIFP
LLKLYNYPATFAVVTSWIESEEPVNYGGVKKPADDFLSWQQIREMQQSGLIEIASHSHDM
HRGLQANPQGNTQPAATTREFSSESYETDTAFQKRIIKDLKTSYDLIEQNTGKAPRAIVW
PYGSYSEYSWSLAQSIGYQQSLVLEQGKNAVNDSHIQRHLISGDPSDIELGLILEPYSYK
TPHRAVHIDLDYVYDPDPVQQHKNLSLLLERVKALNITHVYLQAFADPDGDGNASALYFP
NRHLPVRADLFNRVAWQLKTRSNVKVLAWMPVMAFDLGTDFYQSHGVRELTESGIKLSAN
NYQRLSIFDDSSRQVIKDIYHDLAKHSAFAGVIFHDDAFLTDFEDVSPEALDYYRSQGLM
FELAEELRSEQMIDSWTEVKTKALIDFTVELAEIVRHHNGETITARNIYAQPIINSLAKR
WFAQDLKLFAETYDFSAVMAMPFMEQAADPQAWFMNLLMHIDKQVNKDKVVIELQAYDWL
NQKPVPNVVLLEQVKQAILEGFINIAYYPDDFINNHPELEQIIKGVSINTFPQMEAVYE