Protein Info for B158DRAFT_1600 in Kangiella aquimarina DSM 16071

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 61 PF03966: Trm112p" amino acids 3 to 41 (39 residues), 62.6 bits, see alignment E=1.3e-21

Best Hits

Swiss-Prot: 66% identical to Y634_METCA: UPF0434 protein MCA0634 (MCA0634) from Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)

KEGG orthology group: K09791, hypothetical protein (inferred from 90% identity to kko:Kkor_1373)

Predicted SEED Role

"FIG002473: Protein YcaR in KDO2-Lipid A biosynthesis cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (61 amino acids)

>B158DRAFT_1600 Uncharacterized conserved protein (Kangiella aquimarina DSM 16071)
MNHKLLDVLVCPICKGDLVYKKDSDELVCRFDKLAYPIRDDIPVMLENEARNVSSEELDA
L