Protein Info for B158DRAFT_1560 in Kangiella aquimarina DSM 16071

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00072: Response_reg
  • amino acids 4 to 113 (110 residues), 100.3 bits, E=7.6e-33
• PF00486: Trans_reg_C
  • amino acids 145 to 220 (76 residues), 79.4 bits, E=1.8e-26

Best Hits

Swiss-Prot: 44% identical to PHOP_ECO57: Transcriptional regulatory protein PhoP (phoP) from Escherichia coli O157:H7

KEGG orthology group: K07660, two-component system, OmpR family, response regulator PhoP (inferred from 96% identity to kko:Kkor_1413)

Predicted SEED Role

"Two-component system regulatory protein"

Protein Sequence (224 amino acids)

>B158DRAFT_1560 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Kangiella aquimarina DSM 16071)
MKLLLVEDDDALRQQLVSALKAQNYVVEEAPNGEEALYLAREYQFDLGIFDLGLPDISGM
EVIATLRDEDVQFPVLILTARGHWQDKVDGLAAGADDYLVKPFQTEELLARINALLRRAS
GYAKPEIIKGPISLNSLKQEVKVNGQVMDLTAYEYKVLEYLMLNPDKVVSKTELTEHLYA
QDHDRDSNVLEVFVGRLRKKIDPDGTIKPIDTLRGRGYRLRADL