Protein Info for B158DRAFT_1542 in Kangiella aquimarina DSM 16071

Annotation: ABC-type transport system, involved in lipoprotein release, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 transmembrane" amino acids 19 to 40 (22 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 433 to 453 (21 residues), see Phobius details amino acids 656 to 679 (24 residues), see Phobius details amino acids 705 to 729 (25 residues), see Phobius details amino acids 752 to 772 (21 residues), see Phobius details PF02687: FtsX" amino acids 268 to 388 (121 residues), 58 bits, see alignment E=9.5e-20 amino acids 662 to 778 (117 residues), 70.1 bits, see alignment E=1.7e-23 PF12704: MacB_PCD" amino acids 435 to 614 (180 residues), 36.7 bits, see alignment E=5.5e-13

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 98% identity to kko:Kkor_1429)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (788 amino acids)

>B158DRAFT_1542 ABC-type transport system, involved in lipoprotein release, permease component (Kangiella aquimarina DSM 16071)
MKALNLKLLRDLWHVKGQVIAVALVIASGIATLSMALTTLESLQKTSEQYYSDYNFADAF
VSAVRVPNTFKQRLEAIEGISLVETRIKKYASLDMPDFNEPVMGLLTSIPDQGQPRLNQL
ALRQGRWIAPGASDEVIVNEPFAEAHNLKLSDRISAVMNGKKRYFRIVGIALSPEYIYSI
SPGSLMPDDARYGILWAGQSSLEAAFDLKGAFNDVAFKFDAVSDHQALLKQIDMVLEPYG
GRNSYLRDDQISYWFVNNEIQQLKTTSIIFPVIFLLVSAFLTNMVLSRMITNEREQIGLL
KAFGYSNLQVGAHYFKMVLVMCFVGAVIGLAAGAYLGQANTEMYAEFFRFPLLVYDFSFT
SFIASSGVSVLAALSGIVGSIARVVQLPPAVAMVPPSPDIYHKSFVDTPYIKHWLDQPTR
IAVRQIIRKPLRASFTVIGIAFAVGLMVLAIQMSDAIKYLGISFFNDAQRQDMTMAFYEN
QKQEALYQVKRLPGVIEAEPFRYVSVEFINGTKTHRGSITGLESDATLQPIYDTYSEQVV
ALPEEGMVIGSILAEKLNIGVGDRIYVEFLDKSGLRRDYPVVGIFDTFIGLPAYMNLKTL
NRELGEVGQYFMLNLVVDSQHYDELYKAVKESPAITALMTKQSLLDAFNETVAESMLVFM
FIFIVLSSILVFGVSYNMIRISLSERGRELATLRVLGFTKGETSYILLCEVGLLTLIGLA
LGCFVGWGLTQLLGYAFETELFRIPIIIYPHTYSYAVIVAIIASVMSALFVVKRIHHLDL
IEVLKTKE