Protein Info for B158DRAFT_1325 in Kangiella aquimarina DSM 16071

Annotation: heme exporter protein CcmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 14 to 189 (176 residues), 129.5 bits, see alignment E=7.2e-42 TIGR01191: heme exporter protein CcmC" amino acids 54 to 231 (178 residues), 240.1 bits, see alignment E=8.1e-76

Best Hits

Swiss-Prot: 51% identical to CCMC_PSEAE: Heme exporter protein C (ccmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02195, heme exporter protein C (inferred from 94% identity to kko:Kkor_0980)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>B158DRAFT_1325 heme exporter protein CcmC (Kangiella aquimarina DSM 16071)
MASRWRWFHQLGSPKWFFEKSSKWLPWIWASTLILLAIGLYYSLWASPIEARQGQGHTVR
IMYIHVPAAALSMVGYVVMAIASIIGLVWKMKMAFAASRAIAPIGAAMTFIALFTGAVWG
KPTWGTWWEWDARLTSELLLLFLYLGFIALHSSFAERAKADKAASVLAIVGVINVPIIYF
SVKWWNTLHQGYSVTQKGALAPEFQVPLFIMIGAFYLLFIGLVIMRLRVEVLIREQKSRW
VSDWAASHEPKQMQKRG