Protein Info for B158DRAFT_1324 in Kangiella aquimarina DSM 16071

Annotation: heme exporter protein CcmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 17 to 37 (21 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details PF03379: CcmB" amino acids 2 to 220 (219 residues), 226.9 bits, see alignment E=9.7e-72 TIGR01190: heme exporter protein CcmB" amino acids 5 to 219 (215 residues), 238.7 bits, see alignment E=2.5e-75

Best Hits

Swiss-Prot: 49% identical to CCMB_HAEIN: Heme exporter protein B (ccmB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02194, heme exporter protein B (inferred from 95% identity to kko:Kkor_0979)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>B158DRAFT_1324 heme exporter protein CcmB (Kangiella aquimarina DSM 16071)
MFSALLKRELMVARRNWIGIVIPLFFFIMVVSLFPFGVSPEAPVLQKIAPGIIWVAALLS
TLLSLEQFYRSDYQDGSLEQTLLIAGPTQVASAKILAHWLLTGLPLVIISPLLGILMQIN
HGFVESNHTWVLMLSLLLGTPTLCLIGAIGMSLALAANRNGMLVAILVLPLYVPILIFGT
STVTASLENFSYNGQLAILAALLMIALVVSPFAAGRALKISVS