Protein Info for B158DRAFT_1247 in Kangiella aquimarina DSM 16071

Annotation: cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein (EC 1.10.3.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 186 to 209 (24 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 324 to 348 (25 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 409 to 431 (23 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 9 to 440 (432 residues), 555.7 bits, see alignment E=2.7e-171

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 93% identity to kko:Kkor_1725)

MetaCyc: 60% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (473 amino acids)

>B158DRAFT_1247 cytochrome bd-I ubiquinol oxidase subunit 1 apoprotein (EC 1.10.3.10) (Kangiella aquimarina DSM 16071)
MELLDAVLLARIQFAFTITFHIIFPGLSIGLAAYLTVLEGLWLKTGKPVYLATFKYWLKI
FSIIFGMGVVSGVVMSYQFGTNWSVFSDKTGPVLGPLMGYEVLSAFFLEAGFLGVMLFGM
NKVGKGLHFFATLMVSLGTLMSAFWILSVNSWMQTPAGYEINEAGQFVVANWFDVIFNPS
FPYRLAHMTTAAFLSTAFLVGGVGAWHLYKARKQGERNEVARLMFSMAMWMAALVAPVQL
VIGDLHGLNTLEHQPAKVAAMEGNYQTQKGAPLYLFGMPNSETETVDYAIKIPKAASFIL
THDPDGKLVGLDQFPKDEWPNVPIVFWSFRIMVAIGMGMIAIGLWSLYLRARKKLYDTPL
LLRVAIVFAPSGIIATVAGWFVTEVGRQPYTVYGLLKTVDSASPLDAPAVAASLLAFIIV
YLIVFGTGVWYTMRLMSKRPSPVIEVDDDSQTTVFLSNRVATTSEGKIKEGDQ