Protein Info for B158DRAFT_1200 in Kangiella aquimarina DSM 16071

Annotation: fumarase, class II (EC 4.2.1.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00206: Lyase_1
  • amino acids 11 to 336 (326 residues), 284.5 bits, E=1.3e-88
• PF10415: FumaraseC_C
  • amino acids 401 to 453 (53 residues), 58 bits, 1e-19

Best Hits

Swiss-Prot: 53% identical to FUMC2_PSEAE: Fumarate hydratase class II 2 (fumC2) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 86% identity to kko:Kkor_1778)

MetaCyc: 44% identical to fumarase subunit (Ascaris suum)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle VIII (Chlamydia) (6/6 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• TCA cycle III (animals) (8/10 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (5/10 steps found)
• mixed acid fermentation (9/16 steps found)
• reductive TCA cycle II (6/12 steps found)
• methylaspartate cycle (11/19 steps found)
• pyruvate fermentation to propanoate I (2/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (9/17 steps found)
• L-glutamate degradation VIII (to propanoate) (2/11 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (3/13 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Protein Sequence (453 amino acids)

>B158DRAFT_1200 fumarase, class II (EC 4.2.1.2) (Kangiella aquimarina DSM 16071)
MGFRIEKDSMGEVKVSEDALYAAQTQRALDNFKLSDLKMPIAFIDSILDIKLIAAEINHE
LKLLSKNKYQAITKAIKKIRKDKLVNHQNFPLDIFQTGSGTSTNMNVNEVVAHLASNSRV
TVHPNDDVNMGQSSNDVIPTAISVSASRALIHDLIPALLTLKSTIENKGKLHKKVIKTGR
THLMDAMPLSLQQELSGWAHQIQISLDACQKIVPTIAQLAQGGTAIGTGINSSAKFRGLF
ARKLKNYTGLPFTKSKNTFASIAGQDASVALSGVLNTLATALMKISNDLRWMNSGPVSGL
SEIQLKAIQPGSSIMPGKVNPVIPEAVAMAAAQIIGNHTTITIGAQSGNFQLNVMLPVIA
YNLLQSLHLATTSAEHLARTIAHFEVNQKALADKLDQNAILVTSLAPEIGYENASKIVYK
ARKEERTILDVAKELTDLPEAKLKKLLSPKNLI