Protein Info for B158DRAFT_1188 in Kangiella aquimarina DSM 16071

Annotation: Protein of unknown function (DUF3307).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details PF11750: DUF3307" amino acids 4 to 123 (120 residues), 100.5 bits, see alignment E=3.6e-33

Best Hits

KEGG orthology group: None (inferred from 96% identity to kko:Kkor_1791)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>B158DRAFT_1188 Protein of unknown function (DUF3307). (Kangiella aquimarina DSM 16071)
MTLLFLKLLLAHLVADFVIQPLKWIKDKEQKAFASTGLILHAAVHAVLYAIAFSFNPDYW
LGFAILVVSHYLIDGFKCMAGRYADNYSRPESFINRRTFFVIDQLLHLVIIAFVVSLYFS
GLSEWVIPQEKILALIIAVLLLTRVSSIIIKVLISRWAPLNVYDGDHSLANAGSFIGMLE
RLFIFVFILSGNWHGIGFLLAAKSVFRFGDLKEAHDRKLTEYILIGTLISFGLAIAVGLG
YIGFIQ