Protein Info for B158DRAFT_1111 in Kangiella aquimarina DSM 16071

Annotation: DNA-3-methyladenine glycosylase II (EC 3.2.2.21)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF02805: Ada_Zn_binding" amino acids 11 to 73 (63 residues), 100.4 bits, see alignment E=1.1e-32 PF12833: HTH_18" amino acids 110 to 186 (77 residues), 77.3 bits, see alignment E=2.3e-25 PF00165: HTH_AraC" amino acids 147 to 186 (40 residues), 34.5 bits, see alignment 4.2e-12 PF06029: AlkA_N" amino acids 202 to 316 (115 residues), 112.5 bits, see alignment E=3.5e-36

Best Hits

KEGG orthology group: K13529, AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC: 3.2.2.21] (inferred from 84% identity to kko:Kkor_1879)

Predicted SEED Role

"ADA regulatory protein" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.21

Use Curated BLAST to search for 3.2.2.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>B158DRAFT_1111 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) (Kangiella aquimarina DSM 16071)
MLKAATIKTYQQARLARDPRYDGAFFVAVKSTGIYCRPICPAPAPKEQNVTYYQSSVQAQ
EAGYRPCLRCRPETAPQSSAWLGNQAVLRKAVSRIQAGALNQRSLKDFSESMGITDRYLR
KLFQEHLGVSPITYANHLRLMFAKQLLHQTQLPITDIAFIAGFNSVRRFNDSFKATMQLS
PSQLRKTLINKRSDTDQQAIQLKLHYRPPYDWSLMHDFLQQRELSAIETVTETTYSRSFS
LESCRGFFSAKHDSDDSCFQVAIELDDMSKLLEVTHHIRRVFDLNSDLEVIESSLAQDKA
FKPLIKSGLRLPACWDTFEAGVKAILGQQVSVKAAYTHTASVIEQLGSNYNHQYKLFPTA
QQIVDGDLSFLKMPNSRKQTLHNFAQWYLDTQGEDLSSILNIKGIGPWTYAYIKLRSGMD
SDAFPEKDLGVIKAMEKYQLTSSETWQPWRSYATLQLWHSL