Protein Info for B158DRAFT_1085 in Kangiella aquimarina DSM 16071

Annotation: CDP-diglyceride synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01148: CTP_transf_1
  • amino acids 3 to 288 (286 residues), 211.6 bits, E=2e-66
• PF01864: CarS-like
  • amino acids 190 to 273 (84 residues), 23 bits, E=7.1e-09

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 83% identity to kko:Kkor_1907)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)
• superpathway of phospholipid biosynthesis II (plants) (11/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.41

Use Curated BLAST to search for 2.7.7.41

Protein Sequence (296 amino acids)

>B158DRAFT_1085 CDP-diglyceride synthetase (Kangiella aquimarina DSM 16071)
MLKQRIITALVLLPLALTLLFYPGLKVFSLILIPIFGIIAWEWSRLLQTNTFLKTLFIMI
VLVALGGIYYWLTQREFFEYPTIPTNWTEVHPFKLLMVSIMAWVVAFVLILLYPKAGRTW
LRGPWIRALFGLVFLAAAWLAIVLIRSTDILENHFYGGWLLLLMFVVIWGADVGAYFFGK
TIGRHKLAPVVSPNKTWEGAIGGLVTATVLSTIAAFFIDLSFSLSWFVLLAVILVVVSII
GDLFESMLKRQAGIKDSSQILPGHGGLLDRLDSTLSVAPFFIVALLIFKHGFSLSL