Protein Info for B158DRAFT_0997 in Kangiella aquimarina DSM 16071

Updated annotation (from data): adhesin-associated MmpL efflux pump
Rationale: Conserved cofit with a putative adhesin (B158DRAFT_0994). The MmpL family is involved in efflux of lipids or siderophores (see IPR004869); we speculate that this exports a lipid or saccharide that is attached to the adhesin.
Original annotation: Predicted exporters of the RND superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 782 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 267 to 290 (24 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 328 to 347 (20 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 424 to 443 (20 residues), see Phobius details amino acids 626 to 646 (21 residues), see Phobius details amino acids 653 to 673 (21 residues), see Phobius details amino acids 680 to 701 (22 residues), see Phobius details amino acids 725 to 747 (23 residues), see Phobius details amino acids 755 to 780 (26 residues), see Phobius details PF03176: MMPL" amino acids 184 to 423 (240 residues), 41.3 bits, see alignment E=5e-15 amino acids 490 to 781 (292 residues), 65.2 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 55% identity to pat:Patl_2001)

Predicted SEED Role

"FIG005548: transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (782 amino acids)

>B158DRAFT_0997 adhesin-associated MmpL efflux pump (Kangiella aquimarina DSM 16071)
MTKNKLESIVSKVFFSKRALWISLFAVFTAVMVYFVTQLRVDASFEKNIPLKHEYMQTYI
EYQDQFGGANRVLVALEDTSGNIFNASFFEALKETTNRVAGIAGVNQPQVESLFTPNTRY
IEASEQGLEGGPVIPARFDGSERALKQVEENILKAGIVGRLVSNEFESAMVSAQLLSEYN
PTDVEVTGENGEQMVQTDFVRVAHDLEKIRTDIEAKYPNVEVHIIGFSKMIGDVSDAAGG
VIVFFLIALAITALLVYWYSRSIKLTALPILTSIIAVVWQLGLLTALGYGIDPMSILVPF
LIFAIGVSHGVQMINGVQHNVAHGMKTYNAAIAACAALIVPGGIALLSDTVGFLTLQLIE
IDIIRELAVTASIGVAVLILTNLLLLPLLLSYTHFSDKFVQSVRDREHAREKWWKKIAGF
ARKPASTIIIIVSLLLGIIGYWQSLNMKVGDLQSGAPALRQDSTYNLDNKYITDTYAIGT
DVIYVLAKTKTDGCTYYDIMNNIDQFQWEMNNVKGVQSTISLPQVAKVVNGMLSEGNLKW
KMLPKDEAVLVQSISRVETSTGLLNSDCSVMPVMIFLDDHKAETIERLVSAVKDFRANKA
HEEVEYLLATGPVGVMAATNEAVSAAQIPMMIWVYLAVTLLCLISFRSVRGTICVILPLV
VVSFLAQALMTWLQIGLTVATLPVIALGVGIGVDYGIYIFSRMVGFIRSGMSVADAYFET
LKLTGNAVLFTGLTLAIGVSTWLMSALQFQADMGIMLTFMFLVNMLGAIILLPALAALLY
RR