Protein Info for B158DRAFT_0935 in Kangiella aquimarina DSM 16071

Annotation: Aspartate carbamoyltransferase, catalytic chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF02729: OTCace_N" amino acids 45 to 183 (139 residues), 142.8 bits, see alignment E=9e-46 PF00185: OTCace" amino acids 197 to 343 (147 residues), 50 bits, see alignment E=3.7e-17

Best Hits

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 93% identity to kko:Kkor_2051)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.2

Use Curated BLAST to search for 2.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>B158DRAFT_0935 Aspartate carbamoyltransferase, catalytic chain (Kangiella aquimarina DSM 16071)
MVDQLKDEDLVFSRAKPDVFGDAHPKALLKTIQEDGDALVKLANQHIITCDQFDRQTILQ
LFRLASKYESNPKRYNTPLQGKILISAFYEPSTRTRLSFESAWHRLGGDIMSITDRSTTG
IAKGESLADIGEMFNNYGDCVVLRESNEDSVKEMTSTLRIPIINAGNGTDEHPTQAMADL
YTIFKWRPELLKDNPQKIRVGIVGLPNYMRTVRSLLKIFALFPEIFEEVVIIHDKTDDDI
FTEGQREQLEKAGLNLRLTNRLNKELPELDVVYINAIAWVGDDFESHGDKFVLNAQSPLK
EDAIILHPLARGDELSTDLDETPHNWYFSQARGAVFLRMALLTCMVERTEMVMDVI