Protein Info for B158DRAFT_0888 in Kangiella aquimarina DSM 16071

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 53 to 54 (2 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details PF01027: Bax1-I" amino acids 21 to 229 (209 residues), 95 bits, see alignment E=2.9e-31

Best Hits

KEGG orthology group: K06890, (no description) (inferred from 68% identity to kko:Kkor_2110)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>B158DRAFT_0888 Integral membrane protein, interacts with FtsH (Kangiella aquimarina DSM 16071)
MSYQQTEEQVVVRGGLGDRAKFITKTYNHLLGAIFAFVLISVGLYESGASVAIYNFFAQL
GTFGMIAMMLAFVGTGWFAAHFADRATSKGVQYLNLVIFTAAYAVFFSPLLLLAATKAPG
VIQSAAVVTLVGAGILTAIVFYTRKDFSFLRGIVMWGFGLGLLAILGGAIFGFHLGTWFS
VAMIGISGAAILYDTSNILHHYPEDRYVGAAISLFSSIAMMFIYVLRLFLASEE