Protein Info for B158DRAFT_0887 in Kangiella aquimarina DSM 16071

Annotation: single-strand binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00621: single-stranded DNA-binding protein
  • amino acids 3 to 153 (151 residues), 197 bits, E=1.4e-62
• PF00436: SSB
  • amino acids 6 to 112 (107 residues), 145.5 bits, E=2.6e-47

Best Hits

Swiss-Prot: 64% identical to SSB_PROMI: Single-stranded DNA-binding protein (ssb) from Proteus mirabilis

KEGG orthology group: K03111, single-strand DNA-binding protein (inferred from 93% identity to kko:Kkor_2111)

Predicted SEED Role

"Single-stranded DNA-binding protein" in subsystem DNA repair, bacterial or DNA repair, bacterial RecFOR pathway or pVir Plasmid of Campylobacter

Protein Sequence (153 amino acids)

>B158DRAFT_0887 single-strand binding protein (Kangiella aquimarina DSM 16071)
MASRGINKVILVGNLGKDPEIRYTPDGRAIANITLATSETWKDKNTGQQQEKTEWHRIVI
FGKLAEIAGEYLKKGSQVYFEGKLQTRKWTDQSGQDRYTTEVVVDINGQMQMLGGRSGGE
ASFGGGNNNNQSQKQSPQPAPAMDDDFDDDIPF