Protein Info for B158DRAFT_0886 in Kangiella aquimarina DSM 16071

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 96 (17 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 167 to 192 (26 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 280 to 296 (17 residues), see Phobius details amino acids 302 to 319 (18 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 268 (251 residues), 106 bits, see alignment E=2.1e-34 amino acids 217 to 404 (188 residues), 49.5 bits, see alignment E=3.2e-17 PF00083: Sugar_tr" amino acids 49 to 183 (135 residues), 32.2 bits, see alignment E=5.8e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_2112)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>B158DRAFT_0886 Arabinose efflux permease (Kangiella aquimarina DSM 16071)
MKSSSLTTLEKKSAISLASIFALRMFGLFMLLPVIRILGEGLEGATLPLLGLAIGIYGLS
QAILQLPLGLLSDKIGRKPVIYAGLLVFIVGSLVAANSESVWGLIVGRALQGAGAIASAV
MALAADLSRPHQRSKVMAMIGGSIGLAFALSLVLGPLLSNWLNLQGLFYLIAILAFLALL
VAAFVVPAVPAIDMPKIDLSFAERWRYVTAKGRIFVLALSVFVIHWALVAVFLIVPDKLI
ASGFELSQHSWIYLLVLALSIAIMLPMMINAEKKGWHRQVMQAAFLLLALSLVTLLTDWQ
SLWFWLLVLTLFFAGFNLLEAKLPSTVSNLFGAQYRGTALGIFSTSQFLGAFLGGSVTGY
LLPTLGFTGVVWLNIGLMIIAGLAIGWLGKLPEVKRWVLELDEADTAKTVQESALKLAGV
IEAIADDHKGKVYLRVDDSTIEREELEKLGRIQA