Protein Info for B158DRAFT_0883 in Kangiella aquimarina DSM 16071

Annotation: Membrane protein TerC, possibly involved in tellurium resistance

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 68 (20 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 188 to 207 (20 residues), see Phobius details amino acids 227 to 244 (18 residues), see Phobius details PF03741: TerC" amino acids 15 to 207 (193 residues), 136.9 bits, see alignment E=3.2e-44

Best Hits

KEGG orthology group: None (inferred from 91% identity to kko:Kkor_2114)

Predicted SEED Role

"conserved hypothetical protein-putative integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>B158DRAFT_0883 Membrane protein TerC, possibly involved in tellurium resistance (Kangiella aquimarina DSM 16071)
MDLFTIENLLTLGMLIVLQAVLGFDNLLYISLESKRAPLEKQKQVRRLGIGLAVVLRIVL
LFVLIELIKYVQGELFTIPWTGVIEATFTFESIIVLFGGIFIMYTAVKEIWHMMALEIGE
AHERKPQSAAKVIALIVLMNLVFSFDSILSAMALTDNFWVMAIAIVFSGVLMIWLADTVS
QFLQKNRMFEVLGLFILLVVGIMLLADGGHKSHLLLFGYPIEPMNKATFYFVIAVMVLSD
IVQSKYQKNLMRKKEAAARAKLEQEAQEEIL