Protein Info for B158DRAFT_0847 in Kangiella aquimarina DSM 16071

Annotation: Zn-dependent protease with chaperone function

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 652 transmembrane" amino acids 17 to 40 (24 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details PF01435: Peptidase_M48" amino acids 108 to 327 (220 residues), 85.4 bits, see alignment E=2.4e-28

Best Hits

KEGG orthology group: None (inferred from 86% identity to kko:Kkor_2147)

Predicted SEED Role

"Heat shock protein HtpX / FIG017973: domain of unknown function"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (652 amino acids)

>B158DRAFT_0847 Zn-dependent protease with chaperone function (Kangiella aquimarina DSM 16071)
MDFFEHQEAARKKTRLLVFYFLMAVVLIIAVLNLIGFLIVRSQTSPEYPFSITDWFQHSW
FYAVTIGTLLLIVFGSLFRWFQLSAGGKAVASMVKAREILPDTNDLLERRLLNVVEEMSI
ASGTSVPTVYVMDEEETINAFVAGLETSDTVLVVTRGALENLSRQELQGVVAHEFSHIFN
SDMRINVRLIAVLAGILLIGQAGYFVMRYIRYGNIRSSNKDSGNAVVAVFVIGLSLFVIG
YIGLFFGRLIKAAISRQREFLADASAVQYARDNEGLAGAFIKIRQQGSLLKNSHAEETSH
MCISEPIKLNFSGLASHPPIEKRLTAILPGWRNLAKQIEEQRLREMAQQQEYEDIELGKD
DKPAMDFGFDAIIDTIGQPTTLHQHAAGALLLALPEVIRQAAHSHHSNNHAMHLALALLL
SDDNQVSEPVLNLIAEKTSQKDADQVLELAQHITKDQRHLRLAILDISIPSLRRLSATER
KGFLSLLRQAIHLDSHISEFEYVLYSILQKNLSDSGQGPSNSIKSFNAVSHEIQVILSAT
VHSTGQSDEDKKALYSKLIQPFVKEPSPLLDKTFDAESFHQALKRLNQLTPMLKKPLIQA
LEDAVTYDGKVNPREIELLRAIAECLNCPIPPILEQAQEKLVKNNIQSMSAN