Protein Info for B158DRAFT_0830 in Kangiella aquimarina DSM 16071

Annotation: Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 5 to 184 (180 residues), 109.7 bits, E=2.1e-35
• PF08659: KR
  • amino acids 8 to 125 (118 residues), 36.4 bits, E=7.5e-13
• PF13561: adh_short_C2
  • amino acids 16 to 235 (220 residues), 125 bits, E=5.5e-40

Best Hits

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_2164)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

Protein Sequence (238 amino acids)

>B158DRAFT_0830 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) (Kangiella aquimarina DSM 16071)
MSQQKVAIVTGGAIRVGRAIALELARQGYAIALHYNHSRDSAEQTASDIEALGVQVKLIG
ANLSEPDSCADVVAEAAELGDLSVLINSAAIFPENDTINDDLSHWNQVMNLNLRAPLLLS
QAFAASKPQQAHIINILDARINHPAGDHLVYRLSKAGLWHLTESLARELAPDIQVNGLAL
GAILPPPGADADHFARMAEHIPLKRTGNPQAIADGVAFLIQQSFITGIIIPVDGGEFL