Protein Info for B158DRAFT_0731 in Kangiella aquimarina DSM 16071

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 55 (25 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 207 to 224 (18 residues), see Phobius details amino acids 230 to 259 (30 residues), see Phobius details amino acids 267 to 286 (20 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF01594: AI-2E_transport" amino acids 14 to 334 (321 residues), 180.8 bits, see alignment E=2.1e-57

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_2273)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>B158DRAFT_0731 Predicted permease (Kangiella aquimarina DSM 16071)
MSAETPRVTNALVAIAATFLIIAGLKSASSFVVPVILSLFVAIILGPLYFFFANAKLPVI
KKDMPDWLAIILVVVIMSLFFFMIGTLVGNSVEQFSSNLPRYEMMLRAKFEGLVLWLGGH
GIEVPQTPLAERFSPGVMMNLSASILNGLGSVLSNTFLIILTSIFLLMEASIFGDKMRRA
FPDVESKAHLGLGEVITKIKQYASIKSVVSLLTGAIISLWLWLIGVEYPFLWGLIAFMFN
FIPNIGSIIAAIPAVLLAWLTSDSLTTPLLAAAGYLAVNFVIGNIVEPKFMGKGLGLSTL
VVFLSLLFWGWVLGPVGMLLSVPLTIIVKIFLDANKETQWIGIMLGDK