Protein Info for B158DRAFT_0724 in Kangiella aquimarina DSM 16071

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 712 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 45 to 72 (28 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 125 (25 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 449 to 467 (19 residues), see Phobius details PF02743: dCache_1" amino acids 207 to 434 (228 residues), 45.9 bits, see alignment E=5.5e-16 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 543 to 708 (166 residues), 152 bits, see alignment E=6.1e-49 PF00990: GGDEF" amino acids 549 to 706 (158 residues), 132.4 bits, see alignment E=1.3e-42

Best Hits

Predicted SEED Role

"diguanylate cyclase (GGDEF domain)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (712 amino acids)

>B158DRAFT_0724 diguanylate cyclase (GGDEF) domain (Kangiella aquimarina DSM 16071)
MKQAVSKTISEKALLLGGVYGILGLITNLWFIIPLYGNLSLHLGEVFVISCLITRGLYPA
ILASIITTAGLVYETGNYVFFISAILEIIILNTLLRKGVLLLLADAVFWVMLGIPITYLT
IKYIYDVTSVDFMQVILLKQAVNGVLIVSIVALLKPFIPLRWFSAAVEPEVPKLSDRVFE
LSLNSISLPALIISLFLSDSAADNTEKQMENVLKTRTEYYISYLTNYVDYHLKSLRSLEA
VVLEDDFTDDERDVLLNKWNKIYSGFITMLIANQSGLIISGSPAEFYNNIKSAPEEKRRI
VDRDYFKVPKAELRGYVSEVFRGRGFGDDPIVAISVPILDENKKFLGIVEGSLNIPKFEN
IEESMPDSDGHIIIKDQNKNIIYSSPELDLNALDHFEIVDITPTFTNRMPIFELKGEQYL
YHADTTDYGWRVVALAEPSILIGSYGHNFLRLTIILLFIAVLSLAVTRRFSKQITKPLEN
LVRNFAAHRPIQDSASNIQTSLEIESVREQLKEAQYLTLEYQESLKREVEIKTAELMKMN
DQLKKMSIEDDLTKIFNRRGFEKSVYEIFKLSCRNKTPITFAILDVDHFKAVNDTWGHTV
GDDCLVMIAKELKEHFQRETDFVARYGGEEFVVFLSGGNIDKHCRMLEEFRKKIAGQKVP
ANGNFVKLTISIGVYSLENDFNIGYHHLVSKADELLYQSKNNGRNRITCDSQ